#FILE	yeast_example_MSMS_LTQOrbiTrap_8inj-prot.xml
# UPPER PROB, LOWER PROB, UPPER FPR, LOWER FPR	0.70	0.60	0.059	0.038
# PROBABILITY CUT (0.05 FDR)	0.642857142857143
#PROTEIN_ID	PROTEINPROPHET_PROBABILITY	TOTAL_SPECTRAL_COUNT	NUMBER_INDISTINGUISHABLE_PROTEINS	IDS_INDISTINGUISHABLE_PROTEINS	PEPTIDE_CHARGE	NON_DEGENERATE	INSTANCES	CONTRIBUTING	NSP_PROBABILITY	WEIGHT	PROTEIN_ANNOTATION
YOL138C	1.00	7	1	YOL138C	FGYWYCDSCK_3	Y	1	Y	0.94	1.00	YOL138C SGDID:S000005498,Hypothetical protein, Chr XV from 65350-61325, reverse complement, Uncharacterized ORF
YOL138C	1.00	7	1	YOL138C	YCPFEDIMGSEGDQSSIRLFCER_3	Y	1	Y	0.98	1.00	YOL138C SGDID:S000005498,Hypothetical protein, Chr XV from 65350-61325, reverse complement, Uncharacterized ORF
YOL138C	1.00	7	1	YOL138C	YNFPENNTWATLMNEK_3	Y	5	Y	0.86	1.00	YOL138C SGDID:S000005498,Hypothetical protein, Chr XV from 65350-61325, reverse complement, Uncharacterized ORF
YDR395W	1.00	19	1	YDR395W	DLASNLVEQFLR_2	Y	6	Y	1.00	1.00	SXM1 SGDID:S000002803,Nuclear transport factor (karyopherin) involved in protein transport between the cytoplasm and nucleoplasm; similar to Nmd5p, Cse1p, Lph2p, and the human cellular apoptosis susceptibility protein, CAS1, Chr IV from 1263316-1266150, Verified ORF
YDR395W	1.00	19	1	YDR395W	EAEQQLFEFQK_2	Y	1	Y	0.86	1.00	SXM1 SGDID:S000002803,Nuclear transport factor (karyopherin) involved in protein transport between the cytoplasm and nucleoplasm; similar to Nmd5p, Cse1p, Lph2p, and the human cellular apoptosis susceptibility protein, CAS1, Chr IV from 1263316-1266150, Verified ORF
YDR395W	1.00	19	1	YDR395W	EGSTPDAASADFIFLIGSK_2	Y	2	Y	1.00	1.00	SXM1 SGDID:S000002803,Nuclear transport factor (karyopherin) involved in protein transport between the cytoplasm and nucleoplasm; similar to Nmd5p, Cse1p, Lph2p, and the human cellular apoptosis susceptibility protein, CAS1, Chr IV from 1263316-1266150, Verified ORF
YDR395W	1.00	19	1	YDR395W	LNNILPFINDIFTR_2	Y	10	Y	1.00	1.00	SXM1 SGDID:S000002803,Nuclear transport factor (karyopherin) involved in protein transport between the cytoplasm and nucleoplasm; similar to Nmd5p, Cse1p, Lph2p, and the human cellular apoptosis susceptibility protein, CAS1, Chr IV from 1263316-1266150, Verified ORF
YGR129W	1.00	6	1	YGR129W	QDSSADEEDNKNVPK_2	Y	1	Y	0.27	1.00	SYF2 SGDID:S000003361,Component of the spliceosome complex involved in pre-mRNA splicing; involved in regulation of cell cycle progression, Chr VII from 750405-751052, Verified ORF
YGR129W	1.00	6	1	YGR129W	TLRNLATQTQNSSKQDSSADEEDNK_3	Y	1	Y	0.72	1.00	SYF2 SGDID:S000003361,Component of the spliceosome complex involved in pre-mRNA splicing; involved in regulation of cell cycle progression, Chr VII from 750405-751052, Verified ORF
YGR129W	1.00	6	1	YGR129W	VYSMEDVNDADESVGDTESPEK_2	Y	1	Y	0.97	1.00	SYF2 SGDID:S000003361,Component of the spliceosome complex involved in pre-mRNA splicing; involved in regulation of cell cycle progression, Chr VII from 750405-751052, Verified ORF
YGR129W	1.00	6	1	YGR129W	VYSMEDVNDADESVGDTESPEK_3	Y	3	Y	1.00	1.00	SYF2 SGDID:S000003361,Component of the spliceosome complex involved in pre-mRNA splicing; involved in regulation of cell cycle progression, Chr VII from 750405-751052, Verified ORF
YCL050C	1.00	56	1	YCL050C	FPVIPEHTLLVTNEYQHQTDALTPTDLLTAYK_3	Y	3	Y	1.00	1.00	APA1 SGDID:S000000555,Diadenosine 5',5''-P1,P4-tetraphosphate phosphorylase I (AP4A phosphorylase), involved in catabolism of bis(5'-nucleosidyl) tetraphosphates; has similarity to Apa2p, Chr III from 38801-37836, reverse complement, Verified ORF
YCL050C	1.00	56	1	YCL050C	GQTPEGEDPLGKPEEELTVIPEFGGADNK_3	Y	20	Y	1.00	1.00	APA1 SGDID:S000000555,Diadenosine 5',5''-P1,P4-tetraphosphate phosphorylase I (AP4A phosphorylase), involved in catabolism of bis(5'-nucleosidyl) tetraphosphates; has similarity to Apa2p, Chr III from 38801-37836, reverse complement, Verified ORF
YCL050C	1.00	56	1	YCL050C	HLQILQMPEK_2	Y	1	Y	1.00	1.00	APA1 SGDID:S000000555,Diadenosine 5',5''-P1,P4-tetraphosphate phosphorylase I (AP4A phosphorylase), involved in catabolism of bis(5'-nucleosidyl) tetraphosphates; has similarity to Apa2p, Chr III from 38801-37836, reverse complement, Verified ORF
YCL050C	1.00	56	1	YCL050C	HMVFYNSGPASGSSLDHK_2	Y	4	Y	1.00	1.00	APA1 SGDID:S000000555,Diadenosine 5',5''-P1,P4-tetraphosphate phosphorylase I (AP4A phosphorylase), involved in catabolism of bis(5'-nucleosidyl) tetraphosphates; has similarity to Apa2p, Chr III from 38801-37836, reverse complement, Verified ORF
YCL050C	1.00	56	1	YCL050C	HMVFYNSGPASGSSLDHK_3	Y	16	Y	1.00	1.00	APA1 SGDID:S000000555,Diadenosine 5',5''-P1,P4-tetraphosphate phosphorylase I (AP4A phosphorylase), involved in catabolism of bis(5'-nucleosidyl) tetraphosphates; has similarity to Apa2p, Chr III from 38801-37836, reverse complement, Verified ORF
YCL050C	1.00	56	1	YCL050C	TSMPYLISHMPSLIEKPER_2	Y	4	Y	1.00	1.00	APA1 SGDID:S000000555,Diadenosine 5',5''-P1,P4-tetraphosphate phosphorylase I (AP4A phosphorylase), involved in catabolism of bis(5'-nucleosidyl) tetraphosphates; has similarity to Apa2p, Chr III from 38801-37836, reverse complement, Verified ORF
YCL050C	1.00	56	1	YCL050C	TSMPYLISHMPSLIEKPER_3	Y	8	Y	1.00	1.00	APA1 SGDID:S000000555,Diadenosine 5',5''-P1,P4-tetraphosphate phosphorylase I (AP4A phosphorylase), involved in catabolism of bis(5'-nucleosidyl) tetraphosphates; has similarity to Apa2p, Chr III from 38801-37836, reverse complement, Verified ORF
YJL200C	1.00	24	1	YJL200C	AGSAINYIGNIR_2	Y	4	Y	0.99	1.00	ACO2 SGDID:S000003736,Putative mitochondrial aconitase isozyme; similarity to Aco1p, an aconitase required for the TCA cycle; expression induced during growth on glucose, by amino acid starvation via Gcn4p, and repressed on ethanol, Chr X from 58813-56444, reverse complement, Uncharacterized ORF
YJL200C	1.00	24	1	YJL200C	DKFYPEMDPKPDSNVEIK_3	Y	1	Y	0.96	1.00	ACO2 SGDID:S000003736,Putative mitochondrial aconitase isozyme; similarity to Aco1p, an aconitase required for the TCA cycle; expression induced during growth on glucose, by amino acid starvation via Gcn4p, and repressed on ethanol, Chr X from 58813-56444, reverse complement, Uncharacterized ORF
YJL200C	1.00	24	1	YJL200C	ETGEVNKAYDLDGTEYDIPGLMMK_2	Y	9	Y	0.55	1.00	ACO2 SGDID:S000003736,Putative mitochondrial aconitase isozyme; similarity to Aco1p, an aconitase required for the TCA cycle; expression induced during growth on glucose, by amino acid starvation via Gcn4p, and repressed on ethanol, Chr X from 58813-56444, reverse complement, Uncharacterized ORF
YJL200C	1.00	24	1	YJL200C	IPFFVTPGSEQIR_2	Y	7	Y	1.00	1.00	ACO2 SGDID:S000003736,Putative mitochondrial aconitase isozyme; similarity to Aco1p, an aconitase required for the TCA cycle; expression induced during growth on glucose, by amino acid starvation via Gcn4p, and repressed on ethanol, Chr X from 58813-56444, reverse complement, Uncharacterized ORF
YJL200C	1.00	24	1	YJL200C	KQGVLPLTFANESDYDK_3	Y	1	Y	0.33	1.00	ACO2 SGDID:S000003736,Putative mitochondrial aconitase isozyme; similarity to Aco1p, an aconitase required for the TCA cycle; expression induced during growth on glucose, by amino acid starvation via Gcn4p, and repressed on ethanol, Chr X from 58813-56444, reverse complement, Uncharacterized ORF
YJL200C	1.00	24	1	YJL200C	SDGRPWTVIAEHNYGEGSAR_3	Y	1	Y	0.83	1.00	ACO2 SGDID:S000003736,Putative mitochondrial aconitase isozyme; similarity to Aco1p, an aconitase required for the TCA cycle; expression induced during growth on glucose, by amino acid starvation via Gcn4p, and repressed on ethanol, Chr X from 58813-56444, reverse complement, Uncharacterized ORF
YJL200C	1.00	24	1	YJL200C	VPPYAKLLTNLDK_3	Y	1	Y	0.44	1.00	ACO2 SGDID:S000003736,Putative mitochondrial aconitase isozyme; similarity to Aco1p, an aconitase required for the TCA cycle; expression induced during growth on glucose, by amino acid starvation via Gcn4p, and repressed on ethanol, Chr X from 58813-56444, reverse complement, Uncharacterized ORF
YLR045C	0.99	3	1	YLR045C	DGDTLMGMETDMPPSK_3	Y	1	Y	0.98	1.00	STU2 SGDID:S000004035,Microtubule-associated protein (MAP) of the XMAP215\Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p, Chr XII from 237704-235038, reverse complement, Verified ORF
YLR045C	0.99	3	1	YLR045C	EIDVNK_1	Y	1	Y	0.21	1.00	STU2 SGDID:S000004035,Microtubule-associated protein (MAP) of the XMAP215\Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p, Chr XII from 237704-235038, reverse complement, Verified ORF
YLR045C	0.99	3	1	YLR045C	NVRSQTMNLIVEIYK_3	Y	1	Y	0.33	1.00	STU2 SGDID:S000004035,Microtubule-associated protein (MAP) of the XMAP215\Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p, Chr XII from 237704-235038, reverse complement, Verified ORF
YPL183C	1.00	34	1	YPL183C	IWNLMFFDNDSKLISVSEDCTCR_3	Y	1	Y	0.79	1.00	YPL183C SGDID:S000006104,Hypothetical protein, Chr XVI from 202535-199494, reverse complement, Uncharacterized ORF
YPL183C	1.00	34	1	YPL183C	LISVSEDCTCR_2	Y	3	Y	0.37	1.00	YPL183C SGDID:S000006104,Hypothetical protein, Chr XVI from 202535-199494, reverse complement, Uncharacterized ORF
YPL183C	1.00	34	1	YPL183C	TSATILTGGDDNGLGLSNLKLDDSNK_3	Y	2	Y	0.56	1.00	YPL183C SGDID:S000006104,Hypothetical protein, Chr XVI from 202535-199494, reverse complement, Uncharacterized ORF
YPL183C	1.00	34	1	YPL183C	TSATILTGGDDNGLGLSNLK_2	Y	27	Y	0.96	1.00	YPL183C SGDID:S000006104,Hypothetical protein, Chr XVI from 202535-199494, reverse complement, Uncharacterized ORF
YPL183C	1.00	34	1	YPL183C	VHGLSLSSEGKILAYGAR_3	Y	1	Y	0.63	1.00	YPL183C SGDID:S000006104,Hypothetical protein, Chr XVI from 202535-199494, reverse complement, Uncharacterized ORF
YGR003W	1.00	5	1	YGR003W	ISVPEKLGLSEESFEESWETVK_3	Y	1	Y	0.72	1.00	CUL3 SGDID:S000003235,Ubiquitin-protein ligase, member of the cullin family with similarity to Cdc53p and human CUL3; null mutation has no apparent phenotype, Chr VII from 500136-502370, Verified ORF
YGR003W	1.00	5	1	YGR003W	ITGDLMMYMDK_2	Y	1	Y	0.41	1.00	CUL3 SGDID:S000003235,Ubiquitin-protein ligase, member of the cullin family with similarity to Cdc53p and human CUL3; null mutation has no apparent phenotype, Chr VII from 500136-502370, Verified ORF
YGR003W	1.00	5	1	YGR003W	KVLGTFFTSKLEIMLR_3	Y	1	Y	0.44	1.00	CUL3 SGDID:S000003235,Ubiquitin-protein ligase, member of the cullin family with similarity to Cdc53p and human CUL3; null mutation has no apparent phenotype, Chr VII from 500136-502370, Verified ORF
YGR003W	1.00	5	1	YGR003W	LKDYLIQKLALLR_3	Y	2	Y	0.99	1.00	CUL3 SGDID:S000003235,Ubiquitin-protein ligase, member of the cullin family with similarity to Cdc53p and human CUL3; null mutation has no apparent phenotype, Chr VII from 500136-502370, Verified ORF
YGL060W	0.66	2	1	YGL060W	IHDDESALQKKLLANLSVFVISNCLK_3	Y	1	Y	0.50	1.00	YBP2 SGDID:S000003028,Protein with a role in resistance to oxidative stress; has similarity to Ybp1p, which is involved in regulation of the transcription factor Yap1p via oxidation of specific cysteine residues, Chr VII from 390070-391995, Verified ORF
YGL060W	0.66	2	1	YGL060W	IKCALQELPGHITTAFLQMLLMKTCNESNNDTK_3	Y	1	Y	0.31	1.00	YBP2 SGDID:S000003028,Protein with a role in resistance to oxidative stress; has similarity to Ybp1p, which is involved in regulation of the transcription factor Yap1p via oxidation of specific cysteine residues, Chr VII from 390070-391995, Verified ORF
YBR252W	0.93	5	1	YBR252W	IVDDAQIVVVDSLEESAR_2	Y	5	Y	0.93	1.00	DUT1 SGDID:S000000456,dUTPase, catalyzes the hydrolysis of dUTP to dUMP and PPi and thereby prevents the incorporation of uracil into DNA during replication, Chr II from 722606-723049, Verified ORF
YDL202W	1.00	5	1	YDL202W	GPTATITYEDTNPQQVAK_2	Y	3	Y	0.99	1.00	MRPL11 SGDID:S000002361,Mitochondrial ribosomal protein of the large subunit, Chr IV from 98476-99225, Verified ORF
YDL202W	1.00	5	1	YDL202W	HPLLPLLK_2	Y	2	Y	0.89	1.00	MRPL11 SGDID:S000002361,Mitochondrial ribosomal protein of the large subunit, Chr IV from 98476-99225, Verified ORF
YER075C	0.94	2	1	YER075C	CYRYWQEGNYNGIHVK_2	Y	1	Y	0.41	1.00	PTP3 SGDID:S000000877,Phosphotyrosine-specific protein phosphatase involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm, Chr V from 311195-308409, reverse complement, Verified ORF
YER075C	0.94	2	1	YER075C	HSHSTSDGGILDNYINANYLSLPR_3	Y	1	Y	0.90	1.00	PTP3 SGDID:S000000877,Phosphotyrosine-specific protein phosphatase involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm, Chr V from 311195-308409, reverse complement, Verified ORF
YDR134C	0.97	10	2	YLR110C,YDR134C	ALPAAGALLAGAAALLL_2	Y	10	Y	0.97	1.00	YDR134C SGDID:S000002541,Hypothetical protein, Chr IV from 721478-721068, reverse complement, pseudogene
YHR051W	0.67	6	1	YHR051W	QELGVPLKEELFPSSS_2	Y	6	Y	0.67	1.00	COX6 SGDID:S000001093,Subunit VI of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain; expression is regulated by oxygen levels, Chr VIII from 209699-210145, Verified ORF
YPL171C	0.83	2	1	YPL171C	NSIAAGADGVEIHSANGYLLNQFLDPHSNK_3	Y	1	Y	0.57	1.00	OYE3 SGDID:S000006092,Widely conserved NADPH oxidoreductase containing flavin mononucleotide (FMN), homologous to Oye2p with slight differences in ligand binding and catalytic properties; may be involved in sterol metabolism, Chr XVI from 227370-226168, reverse complement, Verified ORF
YPL171C	0.83	2	1	YPL171C	YDRSTFYTMSAEGYTDYPTYEEAVDLGWNK_3	Y	1	Y	0.61	1.00	OYE3 SGDID:S000006092,Widely conserved NADPH oxidoreductase containing flavin mononucleotide (FMN), homologous to Oye2p with slight differences in ligand binding and catalytic properties; may be involved in sterol metabolism, Chr XVI from 227370-226168, reverse complement, Verified ORF
YDL116W	0.86	9	1	YDL116W	EFKIEQNNEQNPIDPFNIIR_3	Y	1	Y	0.25	1.00	NUP84 SGDID:S000002274,Subunit of the nuclear pore complex (NPC), forms a subcomplex with Nup85p, Nup120p, Nup145p-C, Sec13p, and Seh1p that plays a role in nuclear mRNA export and NPC biogenesis, Chr IV from 251566-253746, Verified ORF
YDL116W	0.86	9	1	YDL116W	EYLDLVARTATLSN_2	Y	1	Y	0.28	1.00	NUP84 SGDID:S000002274,Subunit of the nuclear pore complex (NPC), forms a subcomplex with Nup85p, Nup120p, Nup145p-C, Sec13p, and Seh1p that plays a role in nuclear mRNA export and NPC biogenesis, Chr IV from 251566-253746, Verified ORF
YDL116W	0.86	9	1	YDL116W	IADNISKDENEDQFLEEITQYEHLIK_3	Y	1	Y	0.34	1.00	NUP84 SGDID:S000002274,Subunit of the nuclear pore complex (NPC), forms a subcomplex with Nup85p, Nup120p, Nup145p-C, Sec13p, and Seh1p that plays a role in nuclear mRNA export and NPC biogenesis, Chr IV from 251566-253746, Verified ORF
YDL116W	0.86	9	1	YDL116W	LVEAAKLLKIPK_3	Y	6	Y	0.61	1.00	NUP84 SGDID:S000002274,Subunit of the nuclear pore complex (NPC), forms a subcomplex with Nup85p, Nup120p, Nup145p-C, Sec13p, and Seh1p that plays a role in nuclear mRNA export and NPC biogenesis, Chr IV from 251566-253746, Verified ORF
YPR124W	1.00	12	1	YPR124W	AFGIFLLFVVAAFVYKLLLFVSWCLEVHWFKK_3	Y	1	Y	0.96	1.00	CTR1 SGDID:S000006328,High-affinity copper transporter of the plasma membrane, mediates nearly all copper uptake under low copper conditions; transcriptionally induced at low copper levels and degraded at high copper levels, Chr XVI from 786204-787424, Verified ORF
YPR124W	1.00	12	1	YPR124W	HPEPSPDPIAVADTTSGSDQSTR_3	Y	2	Y	0.99	1.00	CTR1 SGDID:S000006328,High-affinity copper transporter of the plasma membrane, mediates nearly all copper uptake under low copper conditions; transcriptionally induced at low copper levels and degraded at high copper levels, Chr XVI from 786204-787424, Verified ORF
YPR124W	1.00	12	1	YPR124W	LQEQSGNMDQNLLPAEK_2	Y	6	Y	1.00	1.00	CTR1 SGDID:S000006328,High-affinity copper transporter of the plasma membrane, mediates nearly all copper uptake under low copper conditions; transcriptionally induced at low copper levels and degraded at high copper levels, Chr XVI from 786204-787424, Verified ORF
YPR124W	1.00	12	1	YPR124W	TVASSMASMSMDAMSSASK_3	Y	3	Y	1.00	1.00	CTR1 SGDID:S000006328,High-affinity copper transporter of the plasma membrane, mediates nearly all copper uptake under low copper conditions; transcriptionally induced at low copper levels and degraded at high copper levels, Chr XVI from 786204-787424, Verified ORF
YGL167C	1.00	22	1	YGL167C	GDVVAMTGDGVNDAPALK_2	Y	15	Y	0.95	1.00	PMR1 SGDID:S000003135,High affinity Ca2+\Mn2+ P-type ATPase required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting and processing; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease, Chr VII from 190474-187622, reverse complement, Verified ORF
YGL167C	1.00	22	1	YGL167C	HNTKSIFEIGFFTNK_3	Y	1	Y	0.88	1.00	PMR1 SGDID:S000003135,High affinity Ca2+\Mn2+ P-type ATPase required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting and processing; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease, Chr VII from 190474-187622, reverse complement, Verified ORF
YGL167C	1.00	22	1	YGL167C	KRGDVVAMTGDGVNDAPALK_3	Y	1	Y	0.78	1.00	PMR1 SGDID:S000003135,High affinity Ca2+\Mn2+ P-type ATPase required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting and processing; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease, Chr VII from 190474-187622, reverse complement, Verified ORF
YGL167C	1.00	22	1	YGL167C	SSFNDQPNSIVPISER_2	Y	1	Y	0.24	1.00	PMR1 SGDID:S000003135,High affinity Ca2+\Mn2+ P-type ATPase required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting and processing; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease, Chr VII from 190474-187622, reverse complement, Verified ORF
YGL167C	1.00	22	1	YGL167C	TPLQLTMDK_2	Y	2	Y	0.52	1.00	PMR1 SGDID:S000003135,High affinity Ca2+\Mn2+ P-type ATPase required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting and processing; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease, Chr VII from 190474-187622, reverse complement, Verified ORF
YGL167C	1.00	22	1	YGL167C	TSQTIEKSSFNDQPNSIVPISER_3	Y	2	Y	0.50	1.00	PMR1 SGDID:S000003135,High affinity Ca2+\Mn2+ P-type ATPase required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting and processing; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease, Chr VII from 190474-187622, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	AFVVEVMGR_2	N	1	Y	1.00	0.50	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	AVLEFTPETPSPLIGILENK_2	Y	25	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	AVLEFTPETPSPLIGILENK_3	Y	10	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	DAFLEATSEDEIISRASSDASDLLR_3	Y	1	Y	0.98	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	DAFLEATSEDEIISR_2	Y	18	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	DPMGNNITFSGLANATDSAPTSK_2	Y	9	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	DPMGNNITFSGLANATDSAPTSK_3	Y	2	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	ELSWIDVENWHNLGGSEIGTNR_3	Y	10	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	EVWLESFK_1	Y	7	Y	0.99	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	EVWLESFK_2	Y	15	Y	0.99	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	FKHGENSLLSSGTSQDSLR_2	Y	1	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	FKHGENSLLSSGTSQDSLR_3	Y	3	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	GFEVHWAEYNK_2	Y	2	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	GWLSEGGTLIGTAR_1	Y	1	Y	0.78	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	GWLSEGGTLIGTAR_2	Y	5	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	HEWPSLVDELVAEGR_2	Y	6	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	HEWPSLVDELVAEGR_3	Y	3	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	HGENSLLSSGTSQDSLR_2	Y	1	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	IAVMTSGGDSPGMNAAVR_2	Y	27	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	IDLASIREDITLLK_2	Y	1	Y	0.96	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	KMAWEDVRGWLSEGGTLIGTAR_2	Y	52	Y	0.99	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	KMAWEDVRGWLSEGGTLIGTAR_3	Y	7	Y	0.94	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	LNIGIVHVGAPSAALNAATR_2	Y	12	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	LNIGIVHVGAPSAALNAATR_3	Y	31	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	LSDTLVFLKDPMGNNITFSGLANATDSAPTSK_3	Y	6	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	LSDTLVFLK_1	Y	1	Y	0.95	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	LSDTLVFLK_2	Y	18	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	LSEVDASGFR_2	Y	3	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	NEQASSVYSTQLLADIISEASK_2	Y	32	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	NEQASSVYSTQLLADIISEASK_3	Y	8	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	NNTIIVAEGALDDQLNPVTANDVK_2	Y	2	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	NNTIIVAEGALDDQLNPVTANDVK_3	Y	1	Y	0.91	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	RNNTIIVAEGALDDQLNPVTANDVK_3	Y	4	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	SIITNDEALFK_2	Y	7	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	SVASEDLGTIAYYFQK_2	Y	25	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	SVASEDLGTIAYYFQK_3	Y	5	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	TIHFYHTLGFATVK_2	Y	3	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	TIHFYHTLGFATVK_3	Y	7	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	WLATLQGVDAVK_1	Y	3	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YGR240C	1.00	382	1	YGR240C	WLATLQGVDAVK_2	Y	7	Y	1.00	1.00	PFK1 SGDID:S000003472,Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes, Chr VII from 973739-970776, reverse complement, Verified ORF
YER052C	1.00	16	1	YER052C	FGGTSVGKFPVQIVDDIVK_3	Y	1	Y	0.99	1.00	HOM3 SGDID:S000000854,Aspartate kinase (L-aspartate 4-P-transferase); cytoplasmic enzyme that catalyzes the first step in the common pathway for methionine and threonine biosynthesis; expression regulated by Gcn4p and the general control of amino acid synthesis, Chr V from 257957-256374, reverse complement, Verified ORF
YER052C	1.00	16	1	YER052C	FILNPALQAK_2	Y	1	Y	0.81	1.00	HOM3 SGDID:S000000854,Aspartate kinase (L-aspartate 4-P-transferase); cytoplasmic enzyme that catalyzes the first step in the common pathway for methionine and threonine biosynthesis; expression regulated by Gcn4p and the general control of amino acid synthesis, Chr V from 257957-256374, reverse complement, Verified ORF
YER052C	1.00	16	1	YER052C	FPVQIVDDIVK_2	Y	8	Y	1.00	1.00	HOM3 SGDID:S000000854,Aspartate kinase (L-aspartate 4-P-transferase); cytoplasmic enzyme that catalyzes the first step in the common pathway for methionine and threonine biosynthesis; expression regulated by Gcn4p and the general control of amino acid synthesis, Chr V from 257957-256374, reverse complement, Verified ORF
YER052C	1.00	16	1	YER052C	KGESTPPHPPENLSSSFYEK_3	Y	6	Y	1.00	1.00	HOM3 SGDID:S000000854,Aspartate kinase (L-aspartate 4-P-transferase); cytoplasmic enzyme that catalyzes the first step in the common pathway for methionine and threonine biosynthesis; expression regulated by Gcn4p and the general control of amino acid synthesis, Chr V from 257957-256374, reverse complement, Verified ORF
YPR187W	1.00	14	1	YPR187W	ALQISMNAPVFVDLEGETDPLR_2	Y	3	Y	1.00	1.00	RPO26 SGDID:S000006391,RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III; part of central core; similar to bacterial omega subunit, Chr XVI from 911253-911272,911349-911796, Verified ORF
YPR187W	1.00	14	1	YPR187W	TIVTGGNGPEDFQQHEQIR_2	Y	4	Y	1.00	1.00	RPO26 SGDID:S000006391,RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III; part of central core; similar to bacterial omega subunit, Chr XVI from 911253-911272,911349-911796, Verified ORF
YPR187W	1.00	14	1	YPR187W	TIVTGGNGPEDFQQHEQIR_3	Y	7	Y	0.99	1.00	RPO26 SGDID:S000006391,RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III; part of central core; similar to bacterial omega subunit, Chr XVI from 911253-911272,911349-911796, Verified ORF
YOL141W	0.71	5	1	YOL141W	DYVDDSNVDFLTTPK_3	Y	5	Y	0.71	1.00	PPM2 SGDID:S000005501,Putative carboxyl methyl transferase, has similarity to Ppm1p but biochemical activity not yet demonstrated, Chr XV from 56451-58538, Verified ORF
YBR279W	1.00	11	1	YBR279W	KESEGDSKTEGSEQEGENEK_3	Y	9	Y	0.98	1.00	PAF1 SGDID:S000000483,RNA polymerase II-associated protein, defines a large complex that is biochemically and functionally distinct from the Srb-Mediator form of Pol II holoenzyme and is required for full expression of a subset of cell cycle-regulated genes, Chr II from 761253-762590, Verified ORF
YBR279W	1.00	11	1	YBR279W	LDDGDSDDENLDVNHIISR_3	Y	1	Y	0.39	1.00	PAF1 SGDID:S000000483,RNA polymerase II-associated protein, defines a large complex that is biochemically and functionally distinct from the Srb-Mediator form of Pol II holoenzyme and is required for full expression of a subset of cell cycle-regulated genes, Chr II from 761253-762590, Verified ORF
YBR279W	1.00	11	1	YBR279W	LNDKDGIAYYKPLR_3	Y	1	Y	0.70	1.00	PAF1 SGDID:S000000483,RNA polymerase II-associated protein, defines a large complex that is biochemically and functionally distinct from the Srb-Mediator form of Pol II holoenzyme and is required for full expression of a subset of cell cycle-regulated genes, Chr II from 761253-762590, Verified ORF
YJL221C	0.99	4	4	YJL221C,YIL172C,YGR287C,YOL157C	LFCSTQPDLNWENEDCRK_3	Y	4	Y	0.99	1.00	FSP2 SGDID:S000003757,Protein of unknown function, expression is induced during nitrogen limitation, Chr X from 18536-16767, reverse complement, Verified ORF
YLR443W	0.97	2	1	YLR443W	CDSTYTMVEVFDSEGNMHSVK_3	Y	1	Y	0.94	1.00	ECM7 SGDID:S000004435,Non-essential protein of unknown function, Chr XII from 1022622-1023968, Verified ORF
YLR443W	0.97	2	1	YLR443W	YPQRQSTSGEAELMR_2	Y	1	Y	0.41	1.00	ECM7 SGDID:S000004435,Non-essential protein of unknown function, Chr XII from 1022622-1023968, Verified ORF
YGR266W	0.98	4	1	YGR266W	GGHLLLMLGIPIAYPRLVWLEWLFTSKLLAPIK_3	Y	1	Y	0.74	1.00	YGR266W SGDID:S000003498,Protein of unknown function, predicted to contain a single transmembrane domain; localized to both the mitochondrial outer membrane and the plasma membrane, Chr VII from 1022662-1024767, Verified ORF
YGR266W	0.98	4	1	YGR266W	LLAPIKYLSKK_3	Y	3	Y	0.93	1.00	YGR266W SGDID:S000003498,Protein of unknown function, predicted to contain a single transmembrane domain; localized to both the mitochondrial outer membrane and the plasma membrane, Chr VII from 1022662-1024767, Verified ORF
YMR113W	0.91	4	1	YMR113W	NLEPLLQPLLRPIDQVILTR_3	Y	4	Y	0.91	1.00	FOL3 SGDID:S000004719,Dihydrofolate synthetase, involved in folic acid biosynthesis; catalyzes the conversion of dihydropteroate to dihydrofolate in folate coenzyme biosynthesis, Chr XIII from 494998-496281, Verified ORF
YMR296C	1.00	14	1	YMR296C	FIEPYEEEEK_2	Y	1	Y	0.99	1.00	LCB1 SGDID:S000004911,Component of serine palmitoyltransferase, responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine, Chr XIII from 860890-859214, reverse complement, Verified ORF
YMR296C	1.00	14	1	YMR296C	FIVTEGIFHNSGDLAPLPELTKLK_3	Y	2	Y	0.95	1.00	LCB1 SGDID:S000004911,Component of serine palmitoyltransferase, responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine, Chr XIII from 860890-859214, reverse complement, Verified ORF
YMR296C	1.00	14	1	YMR296C	KFIVTEGIFHNSGDLAPLPELTK_3	Y	1	Y	1.00	1.00	LCB1 SGDID:S000004911,Component of serine palmitoyltransferase, responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine, Chr XIII from 860890-859214, reverse complement, Verified ORF
YMR296C	1.00	14	1	YMR296C	RGDVIVADDQVSLPVQNALQLSR_3	Y	2	Y	0.98	1.00	LCB1 SGDID:S000004911,Component of serine palmitoyltransferase, responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine, Chr XIII from 860890-859214, reverse complement, Verified ORF
YMR296C	1.00	14	1	YMR296C	SRKFGYTCEQLFETMSALQK_3	Y	5	Y	0.34	1.00	LCB1 SGDID:S000004911,Component of serine palmitoyltransferase, responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine, Chr XIII from 860890-859214, reverse complement, Verified ORF
YMR296C	1.00	14	1	YMR296C	TPVTMEMPIQNHITITR_3	Y	2	Y	0.78	1.00	LCB1 SGDID:S000004911,Component of serine palmitoyltransferase, responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine, Chr XIII from 860890-859214, reverse complement, Verified ORF
YMR296C	1.00	14	1	YMR296C	YTNVFNLASNNFLQLSATEPVKEVVK_3	Y	1	Y	1.00	1.00	LCB1 SGDID:S000004911,Component of serine palmitoyltransferase, responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine, Chr XIII from 860890-859214, reverse complement, Verified ORF
YDR232W	0.98	1	1	YDR232W	HQIYVQAINFPTVAR_2	Y	1	Y	0.98	1.00	HEM1 SGDID:S000002640,5-aminolevulinate synthase, catalyzes the first step in the heme biosynthetic pathway; an N-terminal signal sequence is required for localization to the mitochondrial matrix; expression is regulated by Hap2p-Hap3p, Chr IV from 927448-929094, Verified ORF
YKL007W	0.97	5	1	YKL007W	INWGSAIGSYR_2	Y	5	Y	0.97	1.00	CAP1 SGDID:S000001490,Alpha subunit of the capping protein (CP) heterodimer (Cap1p and Cap2p) which binds to the barbed ends of actin filaments preventing further polymerization; localized predominantly to cortical actin patches, Chr XI from 428945-429751, Verified ORF
YDL213C	0.94	7	1	YDL213C	RMDIALLQHGTLLK_3	Y	7	Y	0.94	1.00	NOP6 SGDID:S000002372,Protein with similarity to hydrophilins, which are involved in the adaptive response to hyperosmotic conditions; computational analysis of large-scale protein-protein interaction data suggests a possible role in rRNA processing, Chr IV from 77967-77290, reverse complement, Uncharacterized ORF
YOR324C	1.00	5	1	YOR324C	LGNMHSQSQISVNSSPSTSLFYHDLDGSAVNDSSSFLYSR_3	Y	2	Y	0.99	1.00	FRT1 SGDID:S000005851,Tail-anchored endoplasmic reticulum membrane protein that is a substrate of the phosphatase calcineurin, interacts with homolog Frt2p, promotes cell growth in conditions of high Na+, alkaline pH, and cell wall stress, Chr XV from 925037-923229, reverse complement, Verified ORF
YOR324C	1.00	5	1	YOR324C	RGSMSVFQSCHTGLAFNQIQGSSSSQR_3	Y	2	Y	0.62	1.00	FRT1 SGDID:S000005851,Tail-anchored endoplasmic reticulum membrane protein that is a substrate of the phosphatase calcineurin, interacts with homolog Frt2p, promotes cell growth in conditions of high Na+, alkaline pH, and cell wall stress, Chr XV from 925037-923229, reverse complement, Verified ORF
YOR324C	1.00	5	1	YOR324C	SNVPAFLSSSAFSSTSSTSSDSEDVDR_3	Y	1	Y	0.98	1.00	FRT1 SGDID:S000005851,Tail-anchored endoplasmic reticulum membrane protein that is a substrate of the phosphatase calcineurin, interacts with homolog Frt2p, promotes cell growth in conditions of high Na+, alkaline pH, and cell wall stress, Chr XV from 925037-923229, reverse complement, Verified ORF
YNL134C	1.00	10	1	YNL134C	FAIGDYIYGVIHGASVR_3	Y	2	Y	1.00	1.00	YNL134C SGDID:S000005078,Uncharacterized ORF, Chr XIV from 373583-372453, reverse complement, Uncharacterized ORF
YNL134C	1.00	10	1	YNL134C	FPSNGAFAEYSAISSETAYKPAR_3	Y	1	Y	1.00	1.00	YNL134C SGDID:S000005078,Uncharacterized ORF, Chr XIV from 373583-372453, reverse complement, Uncharacterized ORF
YNL134C	1.00	10	1	YNL134C	QDIPIPELEEGFVLIK_2	Y	1	Y	0.78	1.00	YNL134C SGDID:S000005078,Uncharacterized ORF, Chr XIV from 373583-372453, reverse complement, Uncharacterized ORF
YNL134C	1.00	10	1	YNL134C	TVAVAGNPTDWK_2	Y	6	Y	1.00	1.00	YNL134C SGDID:S000005078,Uncharacterized ORF, Chr XIV from 373583-372453, reverse complement, Uncharacterized ORF
YDL167C	0.99	4	1	YDL167C	DISLMEFMSPPLSMATK_2	Y	1	Y	0.55	1.00	NRP1 SGDID:S000002326,Protein of unknown function, rich in asparagine residues, Chr IV from 163155-160996, reverse complement, Verified ORF
YDL167C	0.99	4	1	YDL167C	EGDGNGSSFNEFK_2	Y	1	Y	0.57	1.00	NRP1 SGDID:S000002326,Protein of unknown function, rich in asparagine residues, Chr IV from 163155-160996, reverse complement, Verified ORF
YDL167C	0.99	4	1	YDL167C	RTTDILIQLHKK_3	Y	1	Y	0.32	1.00	NRP1 SGDID:S000002326,Protein of unknown function, rich in asparagine residues, Chr IV from 163155-160996, reverse complement, Verified ORF
YDL167C	0.99	4	1	YDL167C	YNNNINNNNNNINNMTNNR_3	Y	1	Y	0.93	1.00	NRP1 SGDID:S000002326,Protein of unknown function, rich in asparagine residues, Chr IV from 163155-160996, reverse complement, Verified ORF
YEL063C	0.95	3	1	YEL063C	DIEAIVWEDHEPK_2	Y	1	Y	0.33	1.00	CAN1 SGDID:S000000789,Plasma membrane arginine permease, requires phosphatidyl ethanolamine (PE) for localization, exclusively associated with lipid rafts; mutation confers canavanine resistance, Chr V from 33466-31694, reverse complement, Verified ORF
YEL063C	0.95	3	1	YEL063C	VFEWLLNITGVAGFFAWLFISISHIRFMQALKYR_3	Y	1	Y	0.83	1.00	CAN1 SGDID:S000000789,Plasma membrane arginine permease, requires phosphatidyl ethanolamine (PE) for localization, exclusively associated with lipid rafts; mutation confers canavanine resistance, Chr V from 33466-31694, reverse complement, Verified ORF
YEL063C	0.95	3	1	YEL063C	VNGEDTFSMEDGIGDEDEGEVQNAEVKR_3	Y	1	Y	0.53	1.00	CAN1 SGDID:S000000789,Plasma membrane arginine permease, requires phosphatidyl ethanolamine (PE) for localization, exclusively associated with lipid rafts; mutation confers canavanine resistance, Chr V from 33466-31694, reverse complement, Verified ORF
YBR222C	0.75	1	1	YBR222C	TGDQGYFDPEGFLVLTGR_2	Y	1	Y	0.75	1.00	PCS60 SGDID:S000000426,Peroxisomal AMP-binding protein, localizes to both the peroxisomal peripheral membrane and matrix, expression is highly inducible by oleic acid, similar to E. coli long chain acyl-CoA synthetase, Chr II from 668346-666715, reverse complement, Verified ORF
YDL095W	1.00	27	1	YDL095W	GISYWGENNR_2	Y	1	Y	0.42	1.00	PMT1 SGDID:S000002253,Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine\threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals, Chr IV from 287059-289512, Verified ORF
YDL095W	1.00	27	1	YDL095W	HDLTLWYVENNSNPLLPEDTK_3	Y	1	Y	0.28	1.00	PMT1 SGDID:S000002253,Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine\threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals, Chr IV from 287059-289512, Verified ORF
YDL095W	1.00	27	1	YDL095W	IFKDTEGNELDPEVVKK_2	Y	1	Y	1.00	1.00	PMT1 SGDID:S000002253,Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine\threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals, Chr IV from 287059-289512, Verified ORF
YDL095W	1.00	27	1	YDL095W	IFKDTEGNELDPEVVKK_3	Y	2	Y	1.00	1.00	PMT1 SGDID:S000002253,Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine\threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals, Chr IV from 287059-289512, Verified ORF
YDL095W	1.00	27	1	YDL095W	KNSAPGVAQERVIALDTK_3	Y	1	Y	0.26	1.00	PMT1 SGDID:S000002253,Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine\threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals, Chr IV from 287059-289512, Verified ORF
YDL095W	1.00	27	1	YDL095W	MLEEEGANILK_2	Y	6	Y	1.00	1.00	PMT1 SGDID:S000002253,Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine\threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals, Chr IV from 287059-289512, Verified ORF
YDL095W	1.00	27	1	YDL095W	NLVEPHVYESQPTSWPFLLR_3	Y	6	Y	1.00	1.00	PMT1 SGDID:S000002253,Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine\threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals, Chr IV from 287059-289512, Verified ORF
YDL095W	1.00	27	1	YDL095W	QGPVRPFIVTDPSAELASLR_2	Y	1	Y	0.85	1.00	PMT1 SGDID:S000002253,Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine\threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals, Chr IV from 287059-289512, Verified ORF
YDL095W	1.00	27	1	YDL095W	QGPVRPFIVTDPSAELASLR_3	Y	6	Y	1.00	1.00	PMT1 SGDID:S000002253,Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine\threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals, Chr IV from 287059-289512, Verified ORF
YDL095W	1.00	27	1	YDL095W	RVEQDDPVPELDIK_2	Y	2	Y	0.99	1.00	PMT1 SGDID:S000002253,Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine\threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals, Chr IV from 287059-289512, Verified ORF
YOR323C	1.00	69	1	YOR323C	ANAHAIEEANKIDLAVAK_2	Y	1	Y	1.00	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	ANAHAIEEANKIDLAVAK_3	Y	2	Y	1.00	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	FEVMLQGIKDVAELEDPVGKVK_3	Y	1	Y	0.36	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	GDGQVASDYLGAGGNK_2	Y	1	Y	1.00	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	GDKFEVMLQGIK_2	Y	2	Y	0.96	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	GPVGLDGLVSYQYQIR_2	Y	20	Y	1.00	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	GVDSSGVYWNASTR_2	Y	13	Y	1.00	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	ISLDAKTNYPAGCNAMETLLINPK_3	Y	2	Y	0.32	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	IVNDTIAQFQSETGVPVGSVQLIETR_2	Y	3	Y	1.00	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	IVNDTIAQFQSETGVPVGSVQLIETR_3	Y	2	Y	1.00	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	LTEAIQCKTVDADEEQDFDK_3	Y	1	Y	0.75	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	QDVSDLLDQDEYIDLVVPR_2	Y	15	Y	1.00	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	TAYFDKLNELGK_2	Y	1	Y	0.24	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	TVDADEEQDFDKEFLSLDLAAK_3	Y	2	Y	1.00	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YOR323C	1.00	69	1	YOR323C	YGFGAEVGISTSK_2	Y	3	Y	1.00	1.00	PRO2 SGDID:S000005850,Gamma-glutamyl phosphate reductase, catalyzes the second step in proline biosynthesis, Chr XV from 922902-921532, reverse complement, Verified ORF
YMR183C	0.99	6	1	YMR183C	SLDDYISQATDLQYQLK_2	Y	6	Y	0.99	1.00	SSO2 SGDID:S000004795,Plasma membrane t-SNARE involved in fusion of secretory vesicles at the plasma membrane; syntaxin homolog that is functionally redundant with Sso1p, Chr XIII from 627807-626920, reverse complement, Verified ORF
YPL063W	1.00	25	1	YPL063W	DYVEGNLPSPEEQMK_2	Y	2	Y	1.00	1.00	TIM50 SGDID:S000005984,Constituent of the mitochondrial inner membrane presequence translocase (TIM23 complex); may promote binding of incoming precursor proteins to the intermembrane space domain of Tom22p during translocation, Chr XVI from 429936-431366, Verified ORF
YPL063W	1.00	25	1	YPL063W	FPLDLIHEEGQK_3	Y	3	Y	0.98	1.00	TIM50 SGDID:S000005984,Constituent of the mitochondrial inner membrane presequence translocase (TIM23 complex); may promote binding of incoming precursor proteins to the intermembrane space domain of Tom22p during translocation, Chr XVI from 429936-431366, Verified ORF
YPL063W	1.00	25	1	YPL063W	FYGDHKSGGNWAMTALGLGNSLGGSTK_3	Y	1	Y	0.30	1.00	TIM50 SGDID:S000005984,Constituent of the mitochondrial inner membrane presequence translocase (TIM23 complex); may promote binding of incoming precursor proteins to the intermembrane space domain of Tom22p during translocation, Chr XVI from 429936-431366, Verified ORF
YPL063W	1.00	25	1	YPL063W	GQGKNEETSGEGGEDKNEPSSK_3	Y	3	Y	0.98	1.00	TIM50 SGDID:S000005984,Constituent of the mitochondrial inner membrane presequence translocase (TIM23 complex); may promote binding of incoming precursor proteins to the intermembrane space domain of Tom22p during translocation, Chr XVI from 429936-431366, Verified ORF
YPL063W	1.00	25	1	YPL063W	IQQEQMGGQTFTLK_2	Y	6	Y	1.00	1.00	TIM50 SGDID:S000005984,Constituent of the mitochondrial inner membrane presequence translocase (TIM23 complex); may promote binding of incoming precursor proteins to the intermembrane space domain of Tom22p during translocation, Chr XVI from 429936-431366, Verified ORF
YPL063W	1.00	25	1	YPL063W	LIPFLEYLATQQTK_2	Y	3	Y	1.00	1.00	TIM50 SGDID:S000005984,Constituent of the mitochondrial inner membrane presequence translocase (TIM23 complex); may promote binding of incoming precursor proteins to the intermembrane space domain of Tom22p during translocation, Chr XVI from 429936-431366, Verified ORF
YPL063W	1.00	25	1	YPL063W	LIPFLEYLATQQTK_3	Y	1	Y	0.88	1.00	TIM50 SGDID:S000005984,Constituent of the mitochondrial inner membrane presequence translocase (TIM23 complex); may promote binding of incoming precursor proteins to the intermembrane space domain of Tom22p during translocation, Chr XVI from 429936-431366, Verified ORF
YPL063W	1.00	25	1	YPL063W	NEETSGEGGEDKNEPSSKSEK_3	Y	1	Y	0.25	1.00	TIM50 SGDID:S000005984,Constituent of the mitochondrial inner membrane presequence translocase (TIM23 complex); may promote binding of incoming precursor proteins to the intermembrane space domain of Tom22p during translocation, Chr XVI from 429936-431366, Verified ORF
YPL063W	1.00	25	1	YPL063W	SGGNWAMTALGLGNSLGGSTK_3	Y	1	Y	0.86	1.00	TIM50 SGDID:S000005984,Constituent of the mitochondrial inner membrane presequence translocase (TIM23 complex); may promote binding of incoming precursor proteins to the intermembrane space domain of Tom22p during translocation, Chr XVI from 429936-431366, Verified ORF
YPL063W	1.00	25	1	YPL063W	VIIIDTDPNSYK_2	Y	4	Y	1.00	1.00	TIM50 SGDID:S000005984,Constituent of the mitochondrial inner membrane presequence translocase (TIM23 complex); may promote binding of incoming precursor proteins to the intermembrane space domain of Tom22p during translocation, Chr XVI from 429936-431366, Verified ORF
YDR457W	0.99	5	1	YDR457W	DWLSEPANSSDLPENKK_2	Y	1	Y	0.45	1.00	TOM1 SGDID:S000002865,E3 ubiquitin ligase of the hect-domain class; has a role in mRNA export from the nucleus and may regulate transcriptional coactivators, Chr IV from 1369782-1379588, Verified ORF
YDR457W	0.99	5	1	YDR457W	FLGEKDKNTQASSTEK_3	Y	1	Y	0.60	1.00	TOM1 SGDID:S000002865,E3 ubiquitin ligase of the hect-domain class; has a role in mRNA export from the nucleus and may regulate transcriptional coactivators, Chr IV from 1369782-1379588, Verified ORF
YDR457W	0.99	5	1	YDR457W	GLINNLFDFLLDADHAR_2	Y	1	Y	0.23	1.00	TOM1 SGDID:S000002865,E3 ubiquitin ligase of the hect-domain class; has a role in mRNA export from the nucleus and may regulate transcriptional coactivators, Chr IV from 1369782-1379588, Verified ORF
YDR457W	0.99	5	1	YDR457W	NIIIETKLNAIAFVNTIFSPPQVSSK_3	Y	1	Y	0.38	1.00	TOM1 SGDID:S000002865,E3 ubiquitin ligase of the hect-domain class; has a role in mRNA export from the nucleus and may regulate transcriptional coactivators, Chr IV from 1369782-1379588, Verified ORF
YDR457W	0.99	5	1	YDR457W	STEYGTDIDELAR_2	Y	1	Y	0.89	1.00	TOM1 SGDID:S000002865,E3 ubiquitin ligase of the hect-domain class; has a role in mRNA export from the nucleus and may regulate transcriptional coactivators, Chr IV from 1369782-1379588, Verified ORF
YNR016C	1.00	265	1	YNR016C	ADVDAVWAGWGHASENPLLPEK_2	Y	2	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	ADVDAVWAGWGHASENPLLPEK_3	Y	8	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	AGVLEPQGMVGIK_2	Y	4	Y	0.99	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	AIQVEGQPIILTGAPAINK_2	Y	13	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	ALINNVSGYVIK_2	Y	3	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	AVSVSDLSYVANSQSSPLR_2	Y	12	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	AVSVSDLSYVANSQSSPLR_3	Y	4	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	DDISIQEYLTSEANR_3	Y	1	Y	0.34	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	DLDKVALTVLSHSK_3	Y	1	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	DLLQTMFPVDFIHEGKR_3	Y	4	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	DLLQTMFPVDFIHEGK_2	Y	2	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	DMFNEVLK_2	Y	3	Y	0.85	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	EILDLNKQELINASIR_3	Y	1	Y	0.99	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	ENSVLTERTVINGEER_3	Y	1	Y	0.29	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	FQLPSAAFSTFPTVKSK_3	Y	2	Y	0.27	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	FQLPSAAFSTFPTVK_2	Y	12	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	GSFFETLSGWAK_2	Y	13	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	HALPFEGMLPDFGSPVIEGTKPAYK_3	Y	2	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	HTELPGHFIGLNTVDKLEESPLR_3	Y	8	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	HTELPGHFIGLNTVDK_2	Y	2	Y	0.90	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	HTELPGHFIGLNTVDK_3	Y	4	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	IGFPVMIKASEGGGGK_2	N	1	Y	0.83	0.53	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	IGFPVMIK_2	N	9	Y	1.00	0.53	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	IGSFGPQEDEFFNK_2	Y	7	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	IIIKDPQTGAPVPLR_3	Y	6	Y	0.99	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	ITSEDPNDGFKPSGGTLHELNFR_3	Y	5	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	IVEWMSYVPAK_2	Y	2	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	LDEQMEELVAR_2	Y	7	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	LESFAQDLAK_2	Y	2	Y	0.99	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	LGGIPLGVIGVETR_2	Y	11	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	LLETEDFEDNTITTGWLDDLITHK_3	Y	5	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	LLGAVVEPLADIAHK_3	Y	2	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	LPAKLDEQMEELVAR_2	Y	2	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	LPAKLDEQMEELVAR_3	Y	1	Y	0.99	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	LSNFNIKPIFTDNR_2	Y	10	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	LSNFNIKPIFTDNR_3	Y	12	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	LSVDSMTTLLEVENDPTQLR_2	Y	4	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	MEYEITNYSER_2	Y	3	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	NNLILAILK_2	Y	1	Y	0.92	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	NPEYNPDKLLGAVVEPLADIAHK_3	Y	5	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	QPGSTIVAGDIMAIMTLDDPSK_2	Y	4	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	QPGSTIVAGDIMAIMTLDDPSK_3	Y	2	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	QVATWIEENYK_2	Y	4	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	SDHDNAIDGLSEVIK_2	Y	7	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	SLVSTLENILK_1	Y	1	Y	0.88	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	SLVSTLENILK_2	Y	13	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	TGLVSVDDDIYQK_2	Y	3	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	TLYGMNPHSASEIDFEFK_3	Y	2	Y	0.80	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	TVENLIPADPANPNSAETLIQEPGQVWHPNSAFK_3	Y	9	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	VHEGVTVPIVEWK_2	Y	6	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	VIFIGPPGNAMR_2	Y	13	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	VSAIFSTPLQHIVELESK_3	Y	2	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	YYTFNGPNYNENETIR_2	Y	1	Y	1.00	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YNR016C	1.00	265	1	YNR016C	YYTFNGPNYNENETIR_3	Y	1	Y	0.81	1.00	ACC1 SGDID:S000005299,Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids, Chr XIV from 661376-654675, reverse complement, Verified ORF
YER123W	0.85	1	1	YER123W	NINYQSQRNYEQENDAYSDDENDTFCSK_3	Y	1	Y	0.85	1.00	YCK3 SGDID:S000000925,Palmitoylated, vacuolar membrane-localized casein kinase I isoform; negatively regulates vacuole fusion during hypertonic stress via phosphorylation of the HOPS complex subunit, Vps41p; shares overlapping essential functions with Hrr25p, Chr V from 404809-406383, Verified ORF
YKR054C	1.00	13	1	YKR054C	DIKNGSFLDEVEFWSNFYEVLK_3	Y	1	Y	0.32	1.00	DYN1 SGDID:S000001762,Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p, Chr XI from 547567-535289, reverse complement, Verified ORF
YKR054C	1.00	13	1	YKR054C	IFEQDCLDLESK_2	Y	1	Y	0.23	1.00	DYN1 SGDID:S000001762,Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p, Chr XI from 547567-535289, reverse complement, Verified ORF
YKR054C	1.00	13	1	YKR054C	ILFETDNLDHTTPATITR_2	Y	2	Y	0.32	1.00	DYN1 SGDID:S000001762,Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p, Chr XI from 547567-535289, reverse complement, Verified ORF
YKR054C	1.00	13	1	YKR054C	LETAVQLAVHLISSYR_3	Y	1	Y	0.41	1.00	DYN1 SGDID:S000001762,Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p, Chr XI from 547567-535289, reverse complement, Verified ORF
YKR054C	1.00	13	1	YKR054C	LVHFVTNKESIETR_3	Y	1	Y	0.52	1.00	DYN1 SGDID:S000001762,Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p, Chr XI from 547567-535289, reverse complement, Verified ORF
YKR054C	1.00	13	1	YKR054C	QFEMYK_2	Y	1	Y	0.41	1.00	DYN1 SGDID:S000001762,Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p, Chr XI from 547567-535289, reverse complement, Verified ORF
YKR054C	1.00	13	1	YKR054C	SGFSMSEEFLKKCMQFYYMQK_3	Y	3	Y	0.87	1.00	DYN1 SGDID:S000001762,Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p, Chr XI from 547567-535289, reverse complement, Verified ORF
YKR054C	1.00	13	1	YKR054C	SKMDSWILYVSKHLLTIYER_2	Y	1	Y	0.23	1.00	DYN1 SGDID:S000001762,Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p, Chr XI from 547567-535289, reverse complement, Verified ORF
YKR054C	1.00	13	1	YKR054C	SLEEGVENINNLSQSLNESWSVR_2	Y	1	Y	0.69	1.00	DYN1 SGDID:S000001762,Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p, Chr XI from 547567-535289, reverse complement, Verified ORF
YKR054C	1.00	13	1	YKR054C	VNFDFALAAAYSELR_3	Y	1	Y	0.26	1.00	DYN1 SGDID:S000001762,Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p, Chr XI from 547567-535289, reverse complement, Verified ORF
YMR315W	1.00	21	1	YMR315W	AGKPVILEKPIAANLDQAK_3	Y	2	Y	1.00	1.00	YMR315W SGDID:S000004932,Hypothetical protein, Chr XIII from 902799-903848, Uncharacterized ORF
YMR315W	1.00	21	1	YMR315W	HLPSYQEFPDKFK_3	Y	7	Y	1.00	1.00	YMR315W SGDID:S000004932,Hypothetical protein, Chr XIII from 902799-903848, Uncharacterized ORF
YMR315W	1.00	21	1	YMR315W	IAESTPLPVGVAENWLYLPCIK_3	Y	1	Y	0.63	1.00	YMR315W SGDID:S000004932,Hypothetical protein, Chr XIII from 902799-903848, Uncharacterized ORF
YMR315W	1.00	21	1	YMR315W	IGPVVAFTHNSTGPFVTQNK_3	Y	10	Y	0.99	1.00	YMR315W SGDID:S000004932,Hypothetical protein, Chr XIII from 902799-903848, Uncharacterized ORF
YMR315W	1.00	21	1	YMR315W	VDNDESFGVNAEFLNFHEAVSKKDK_3	Y	1	Y	0.29	1.00	YMR315W SGDID:S000004932,Hypothetical protein, Chr XIII from 902799-903848, Uncharacterized ORF
YAL024C	0.96	5	1	YAL024C	FYTFKVNHELLSK_3	Y	2	Y	0.84	1.00	LTE1 SGDID:S000000022,Putative GDP\GTP exchange factor required for mitotic exit at low temperatures; acts as a guanine nucleotide exchange factor (GEF) for Tem1p, which is a key regulator of mitotic exit; physically associates with Ras2p-GTP, Chr I from 105873-101566, reverse complement, Verified ORF
YAL024C	0.96	5	1	YAL024C	KNLNEIANMLDDSINDDPITVALMK_3	Y	1	Y	0.52	1.00	LTE1 SGDID:S000000022,Putative GDP\GTP exchange factor required for mitotic exit at low temperatures; acts as a guanine nucleotide exchange factor (GEF) for Tem1p, which is a key regulator of mitotic exit; physically associates with Ras2p-GTP, Chr I from 105873-101566, reverse complement, Verified ORF
YAL024C	0.96	5	1	YAL024C	NFITPQDLHDLLIYRFR_3	Y	1	Y	0.35	1.00	LTE1 SGDID:S000000022,Putative GDP\GTP exchange factor required for mitotic exit at low temperatures; acts as a guanine nucleotide exchange factor (GEF) for Tem1p, which is a key regulator of mitotic exit; physically associates with Ras2p-GTP, Chr I from 105873-101566, reverse complement, Verified ORF
YAL024C	0.96	5	1	YAL024C	NNKYFFSPDDGSIDVASPMKNVEELK_3	Y	1	Y	0.27	1.00	LTE1 SGDID:S000000022,Putative GDP\GTP exchange factor required for mitotic exit at low temperatures; acts as a guanine nucleotide exchange factor (GEF) for Tem1p, which is a key regulator of mitotic exit; physically associates with Ras2p-GTP, Chr I from 105873-101566, reverse complement, Verified ORF
YDR035W	1.00	8	1	YDR035W	ELASGLSFPIGFK_2	Y	3	Y	0.99	1.00	ARO3 SGDID:S000002442,3-deoxy-D-arabino-heptulosonate-7-phosphate (DAHP) synthase, catalyzes the first step in aromatic amino acid biosynthesis and is feedback-inhibited by phenylalanine, Chr IV from 521813-522925, Verified ORF
YDR035W	1.00	8	1	YDR035W	GLINDPDMNNSFQINK_2	Y	3	Y	0.95	1.00	ARO3 SGDID:S000002442,3-deoxy-D-arabino-heptulosonate-7-phosphate (DAHP) synthase, catalyzes the first step in aromatic amino acid biosynthesis and is feedback-inhibited by phenylalanine, Chr IV from 521813-522925, Verified ORF
YDR035W	1.00	8	1	YDR035W	IKGYDPLTPPDLLQHEFPISAK_3	Y	2	Y	1.00	1.00	ARO3 SGDID:S000002442,3-deoxy-D-arabino-heptulosonate-7-phosphate (DAHP) synthase, catalyzes the first step in aromatic amino acid biosynthesis and is feedback-inhibited by phenylalanine, Chr IV from 521813-522925, Verified ORF
YER151C	1.00	11	1	YER151C	FSEYELLPFK_2	Y	1	Y	1.00	1.00	UBP3 SGDID:S000000953,Ubiquitin-specific protease that interacts with Bre5p to co-regulate anterograde and retrograde transport between endoplasmic reticulum and Golgi compartments; inhibitor of gene silencing; cleaves ubiquitin fusions but not polyubiquitin, Chr V from 472419-469681, reverse complement, Verified ORF
YER151C	1.00	11	1	YER151C	IDDVNITELEDDDVLKGGEEASDSR_3	Y	2	Y	0.74	1.00	UBP3 SGDID:S000000953,Ubiquitin-specific protease that interacts with Bre5p to co-regulate anterograde and retrograde transport between endoplasmic reticulum and Golgi compartments; inhibitor of gene silencing; cleaves ubiquitin fusions but not polyubiquitin, Chr V from 472419-469681, reverse complement, Verified ORF
YER151C	1.00	11	1	YER151C	NASPR_1	Y	4	Y	0.46	1.00	UBP3 SGDID:S000000953,Ubiquitin-specific protease that interacts with Bre5p to co-regulate anterograde and retrograde transport between endoplasmic reticulum and Golgi compartments; inhibitor of gene silencing; cleaves ubiquitin fusions but not polyubiquitin, Chr V from 472419-469681, reverse complement, Verified ORF
YER151C	1.00	11	1	YER151C	QASNKTVSGSMVTK_2	Y	1	Y	0.21	1.00	UBP3 SGDID:S000000953,Ubiquitin-specific protease that interacts with Bre5p to co-regulate anterograde and retrograde transport between endoplasmic reticulum and Golgi compartments; inhibitor of gene silencing; cleaves ubiquitin fusions but not polyubiquitin, Chr V from 472419-469681, reverse complement, Verified ORF
YER151C	1.00	11	1	YER151C	TETHGEEEDAHDK_3	Y	3	Y	0.69	1.00	UBP3 SGDID:S000000953,Ubiquitin-specific protease that interacts with Bre5p to co-regulate anterograde and retrograde transport between endoplasmic reticulum and Golgi compartments; inhibitor of gene silencing; cleaves ubiquitin fusions but not polyubiquitin, Chr V from 472419-469681, reverse complement, Verified ORF
YPR019W	0.92	3	1	YPR019W	CNVCDHTMAVEIDR_2	Y	1	Y	0.79	1.00	CDC54 SGDID:S000006223,Essential helicase component of heterohexameric MCM2-7 complexes which bind pre-replication complexes on DNA and melt the DNA prior to replication; accumulates in the nucleus in G1; homolog of S. pombe Cdc21p, Chr XVI from 596747-599548, Verified ORF
YPR019W	0.92	3	1	YPR019W	EIMNVLKDQASDSMSFNELIK_2	Y	1	Y	0.53	1.00	CDC54 SGDID:S000006223,Essential helicase component of heterohexameric MCM2-7 complexes which bind pre-replication complexes on DNA and melt the DNA prior to replication; accumulates in the nucleus in G1; homolog of S. pombe Cdc21p, Chr XVI from 596747-599548, Verified ORF
YPR019W	0.92	3	1	YPR019W	NVVELEDVQEAVRLIR_3	Y	1	Y	0.23	1.00	CDC54 SGDID:S000006223,Essential helicase component of heterohexameric MCM2-7 complexes which bind pre-replication complexes on DNA and melt the DNA prior to replication; accumulates in the nucleus in G1; homolog of S. pombe Cdc21p, Chr XVI from 596747-599548, Verified ORF
YPR190C	0.98	1	1	YPR190C	TPGLTFNAIDLAR_2	Y	1	Y	0.98	1.00	RPC82 SGDID:S000006394,RNA polymerase III subunit C82, Chr XVI from 919037-917073, reverse complement, Verified ORF
YDR353W	1.00	135	1	YDR353W	FGTEIITETVSK_1	Y	2	Y	0.83	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	FGTEIITETVSK_2	Y	18	Y	1.00	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	GISACAVCDGAVPIFR_2	N	2	Y	0.99	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	IEILYNTVALEAK_2	Y	6	Y	1.00	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	IVAGQVDTDEAGYIK_2	Y	20	Y	1.00	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	KNEETDLPVSGLFYAIGHTPATK_2	Y	4	Y	1.00	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	KNEETDLPVSGLFYAIGHTPATK_3	Y	14	Y	1.00	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	LWTEFNEDAEPVTTDAIILATGASAK_2	N	15	Y	1.00	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	LWTEFNEDAEPVTTDAIILATGASAK_3	N	3	Y	1.00	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	MHLPGEETYWQK_2	Y	10	Y	1.00	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	NEKIEILYNTVALEAKGDGK_2	Y	4	Y	0.97	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	TVPGSSLTSVPGFFAAGDVQDSKYR_3	Y	1	Y	0.21	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	TVPGSSLTSVPGFFAAGDVQDSK_2	Y	22	Y	1.00	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	TVPGSSLTSVPGFFAAGDVQDSK_3	Y	2	Y	1.00	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YDR353W	1.00	135	1	YDR353W	VTIIGSGPAAHTAAIYLAR_3	N	12	Y	1.00	1.00	TRR1 SGDID:S000002761,Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress, Chr IV from 1183292-1184251, Verified ORF
YKL214C	0.99	2	1	YKL214C	IPLDVSDYTLDDMIK_2	Y	2	Y	0.99	1.00	YRA2 SGDID:S000001697,Member of the REF (RNA and export factor binding proteins) family; when overexpressed, can substitute for the function of Yra1p in export of poly(A)+ mRNA from the nucleus, Chr XI from 31694-31083, reverse complement, Verified ORF
YPL119C	0.90	4	1	YPL119C	NTGTSNWGSIGGGFR_3	Y	2	Y	0.88	1.00	DBP1 SGDID:S000006040,Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs, Chr XVI from 326263-324410, reverse complement, Verified ORF
YPL119C	0.90	4	1	YPL119C	TGGFLFPLFTELFR_2	Y	2	Y	0.21	1.00	DBP1 SGDID:S000006040,Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs, Chr XVI from 326263-324410, reverse complement, Verified ORF
YDL125C	1.00	40	1	YDL125C	LHDIPDEFLTDAMPIAK_2	Y	5	Y	1.00	1.00	HNT1 SGDID:S000002283,Adenosine 5'-monophosphoramidase; interacts physically and genetically with Kin28p, a CDK and TFIIK subunit, and genetically with CAK1; member of the histidine triad (HIT) superfamily of nucleotide-binding proteins and similar to Hint, Chr IV from 239606-239510,239398-239019, reverse complement, Verified ORF
YDL125C	1.00	40	1	YDL125C	LHDIPDEFLTDAMPIAK_3	Y	12	Y	1.00	1.00	HNT1 SGDID:S000002283,Adenosine 5'-monophosphoramidase; interacts physically and genetically with Kin28p, a CDK and TFIIK subunit, and genetically with CAK1; member of the histidine triad (HIT) superfamily of nucleotide-binding proteins and similar to Hint, Chr IV from 239606-239510,239398-239019, reverse complement, Verified ORF
YDL125C	1.00	40	1	YDL125C	SGLIVGWPAQETDFDKLGK_3	Y	5	Y	0.98	1.00	HNT1 SGDID:S000002283,Adenosine 5'-monophosphoramidase; interacts physically and genetically with Kin28p, a CDK and TFIIK subunit, and genetically with CAK1; member of the histidine triad (HIT) superfamily of nucleotide-binding proteins and similar to Hint, Chr IV from 239606-239510,239398-239019, reverse complement, Verified ORF
YDL125C	1.00	40	1	YDL125C	SGLIVGWPAQETDFDK_2	Y	11	Y	1.00	1.00	HNT1 SGDID:S000002283,Adenosine 5'-monophosphoramidase; interacts physically and genetically with Kin28p, a CDK and TFIIK subunit, and genetically with CAK1; member of the histidine triad (HIT) superfamily of nucleotide-binding proteins and similar to Hint, Chr IV from 239606-239510,239398-239019, reverse complement, Verified ORF
YDL125C	1.00	40	1	YDL125C	YSYAFLDIQPTAEGHALIIPK_3	Y	7	Y	1.00	1.00	HNT1 SGDID:S000002283,Adenosine 5'-monophosphoramidase; interacts physically and genetically with Kin28p, a CDK and TFIIK subunit, and genetically with CAK1; member of the histidine triad (HIT) superfamily of nucleotide-binding proteins and similar to Hint, Chr IV from 239606-239510,239398-239019, reverse complement, Verified ORF
YHR186C	1.00	18	1	YHR186C	HCQVMQNQLEVIDLRKLK_3	Y	5	Y	0.53	1.00	KOG1 SGDID:S000001229,Subunit of TORC1, a rapamycin-sensitive complex involved in growth control that contains Tor1p or Tor2p, Lst8p and Tco89p; contains four HEAT repeats and seven WD-40 repeats; may act as a scaffold protein to couple TOR and its effectors, Chr VIII from 480672-475999, reverse complement, Verified ORF
YHR186C	1.00	18	1	YHR186C	IRALVLLSRFLDLGPWAVYLSLSIGIFPYVLK_3	Y	1	Y	0.91	1.00	KOG1 SGDID:S000001229,Subunit of TORC1, a rapamycin-sensitive complex involved in growth control that contains Tor1p or Tor2p, Lst8p and Tco89p; contains four HEAT repeats and seven WD-40 repeats; may act as a scaffold protein to couple TOR and its effectors, Chr VIII from 480672-475999, reverse complement, Verified ORF
YHR186C	1.00	18	1	YHR186C	QSLDPCVEDVKRFCNSLR_2	Y	9	Y	0.77	1.00	KOG1 SGDID:S000001229,Subunit of TORC1, a rapamycin-sensitive complex involved in growth control that contains Tor1p or Tor2p, Lst8p and Tco89p; contains four HEAT repeats and seven WD-40 repeats; may act as a scaffold protein to couple TOR and its effectors, Chr VIII from 480672-475999, reverse complement, Verified ORF
YHR186C	1.00	18	1	YHR186C	VDNNAFKKEQQQHDPK_3	Y	3	Y	0.72	1.00	KOG1 SGDID:S000001229,Subunit of TORC1, a rapamycin-sensitive complex involved in growth control that contains Tor1p or Tor2p, Lst8p and Tco89p; contains four HEAT repeats and seven WD-40 repeats; may act as a scaffold protein to couple TOR and its effectors, Chr VIII from 480672-475999, reverse complement, Verified ORF
YJR092W	1.00	18	1	YJR092W	EIDNEMEQTK_2	Y	2	Y	0.90	1.00	BUD4 SGDID:S000003852,Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding; potential Cdc28p substrate, Chr X from 598650-602996, Verified ORF
YJR092W	1.00	18	1	YJR092W	GYEASFSDTDSRPEGMNNSDAITLNMFDDFEEDK_3	Y	1	Y	0.88	1.00	BUD4 SGDID:S000003852,Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding; potential Cdc28p substrate, Chr X from 598650-602996, Verified ORF
YJR092W	1.00	18	1	YJR092W	LLNTSNNSHSDSR_2	Y	12	Y	0.46	1.00	BUD4 SGDID:S000003852,Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding; potential Cdc28p substrate, Chr X from 598650-602996, Verified ORF
YJR092W	1.00	18	1	YJR092W	SHRATYAIVFDNGENVVQTPWESLPYDGNIRINK_3	Y	1	Y	0.69	1.00	BUD4 SGDID:S000003852,Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding; potential Cdc28p substrate, Chr X from 598650-602996, Verified ORF
YJR092W	1.00	18	1	YJR092W	TSAEEHDLSSSCEDQSVSEARNKDR_3	Y	2	Y	0.45	1.00	BUD4 SGDID:S000003852,Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding; potential Cdc28p substrate, Chr X from 598650-602996, Verified ORF
YLR078C	0.96	3	1	YLR078C	DKLVFWIALILLIIGIYYVLK_3	Y	3	Y	0.96	1.00	BOS1 SGDID:S000004068,v-SNARE (vesicle specific SNAP receptor), localized to the endoplasmic reticulum membrane and necessary for vesicular transport from the ER to the Golgi, Chr XII from 286560-286558,286468-285737, reverse complement, Verified ORF
YIL053W	1.00	269	1	YIL053W	AAGCKIVGIATTFDLDFLK_3	Y	1	Y	0.38	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	DKPYFDAEHVIHISHGWR_3	Y	1	Y	0.24	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	FAPDFADEEYVNKLEGEIPEK_2	Y	21	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	FAPDFADEEYVNKLEGEIPEK_3	Y	40	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	FAPDFADEEYVNK_2	Y	11	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	IKRPEYFITANDVK_2	Y	15	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	IKRPEYFITANDVK_3	Y	14	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	IVGIATTFDLDFLK_2	Y	43	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	KWFDILK_1	Y	3	Y	0.37	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	KWFDILK_2	Y	14	Y	0.94	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	LEGEIPEKYGEHSIEVPGAVK_3	Y	3	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	NGLGFPINEQDPSK_2	Y	1	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	NHESIRVGEYNAETDEVELIFDDYLYAKDDLLK_3	Y	1	Y	0.25	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	RPEYFITANDVK_2	Y	9	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	RPEYFITANDVK_3	Y	2	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	VVVFEDAPAGIAAGK_1	N	12	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	VVVFEDAPAGIAAGK_2	N	49	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	VVVFEDAPAGIAAGK_3	N	2	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	WFDILK_1	Y	8	Y	0.96	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	WFDILK_2	Y	14	Y	0.23	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YIL053W	1.00	269	1	YIL053W	YGEHSIEVPGAVK_2	Y	5	Y	1.00	1.00	RHR2 SGDID:S000001315,Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p\Gpp2p isoform, osmotic stress, Chr IX from 255113-255865, Verified ORF
YDR258C	1.00	6	1	YDR258C	FQPILLNEPSVSDTISILR_2	Y	2	Y	0.70	1.00	HSP78 SGDID:S000002666,Oligomeric mitochondrial matrix chaperone that cooperates with Ssc1p in mitochondrial thermotolerance after heat shock; prevents the aggregation of misfolded matrix proteins; component of the mitochondrial proteolysis system, Chr IV from 974239-971804, reverse complement, Verified ORF
YDR258C	1.00	6	1	YDR258C	SKDGDKVNLLHDSVTSDDISK_3	Y	2	Y	1.00	1.00	HSP78 SGDID:S000002666,Oligomeric mitochondrial matrix chaperone that cooperates with Ssc1p in mitochondrial thermotolerance after heat shock; prevents the aggregation of misfolded matrix proteins; component of the mitochondrial proteolysis system, Chr IV from 974239-971804, reverse complement, Verified ORF
YDR258C	1.00	6	1	YDR258C	VVGQDEAIAAISDAVR_2	Y	2	Y	0.99	1.00	HSP78 SGDID:S000002666,Oligomeric mitochondrial matrix chaperone that cooperates with Ssc1p in mitochondrial thermotolerance after heat shock; prevents the aggregation of misfolded matrix proteins; component of the mitochondrial proteolysis system, Chr IV from 974239-971804, reverse complement, Verified ORF
YNL243W	1.00	13	1	YNL243W	AVAGATNVLITTASK_2	Y	2	Y	0.98	1.00	SLA2 SGDID:S000005187,Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo, Chr XIV from 188052-190958, Verified ORF
YNL243W	1.00	13	1	YNL243W	EAQYFFEDLMSENLNQVGDEEK_3	Y	1	Y	0.73	1.00	SLA2 SGDID:S000005187,Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo, Chr XIV from 188052-190958, Verified ORF
YNL243W	1.00	13	1	YNL243W	EVAASTIQLVAASR_2	Y	2	Y	1.00	1.00	SLA2 SGDID:S000005187,Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo, Chr XIV from 188052-190958, Verified ORF
YNL243W	1.00	13	1	YNL243W	LPVDAPDVFLINDVDESKEIK_3	Y	1	Y	0.68	1.00	SLA2 SGDID:S000005187,Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo, Chr XIV from 188052-190958, Verified ORF
YNL243W	1.00	13	1	YNL243W	LPVDAPDVFLINDVDESK_2	Y	3	Y	0.91	1.00	SLA2 SGDID:S000005187,Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo, Chr XIV from 188052-190958, Verified ORF
YNL243W	1.00	13	1	YNL243W	QLANKDEQLTALQDQLDVWER_3	Y	2	Y	0.99	1.00	SLA2 SGDID:S000005187,Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo, Chr XIV from 188052-190958, Verified ORF
YNL243W	1.00	13	1	YNL243W	VQQLESEITTMDSTASK_2	Y	2	Y	1.00	1.00	SLA2 SGDID:S000005187,Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo, Chr XIV from 188052-190958, Verified ORF
YKR060W	0.75	1	1	YKR060W	VHHLLPEVLGSR_2	Y	1	Y	0.75	1.00	UTP30 SGDID:S000001768,Possible U3 snoRNP protein involved in maturation of pre-18S rRNA, based on computational analysis of large-scale protein-protein interaction data, Chr XI from 556160-556984, Uncharacterized ORF
YLR318W	0.83	28	1	YLR318W	MECMR_2	Y	28	Y	0.83	1.00	EST2 SGDID:S000004310,Reverse transcriptase subunit of the telomerase holoenzyme, essential for telomerase core catalytic activity, involved in other aspects of telomerase assembly and function; mutations in human homolog are associated with aplastic anemia, Chr XII from 766542-769196, Verified ORF
YFL009W	0.96	7	1	YFL009W	CISASMDTTIRIWDLENIWNNGECSYATNSASPCAK_3	Y	1	Y	0.31	1.00	CDC4 SGDID:S000001885,F-box protein required for G1\S and G2\M transition, associates with Skp1p and Cdc53p to form a complex, SCFCdc4, which acts as ubiquitin-protein ligase directing ubiquitination of the phosphorylated CDK inhibitor Sic1p, Chr VI from 116139-118478, Verified ORF
YFL009W	0.96	7	1	YFL009W	IWDLENIWNNGECSYATNSASPCAK_3	Y	6	Y	0.94	1.00	CDC4 SGDID:S000001885,F-box protein required for G1\S and G2\M transition, associates with Skp1p and Cdc53p to form a complex, SCFCdc4, which acts as ubiquitin-protein ligase directing ubiquitination of the phosphorylated CDK inhibitor Sic1p, Chr VI from 116139-118478, Verified ORF
YKL195W	1.00	18	1	YKL195W	KDPEHSDDEKSQQGQSDDK_3	Y	12	Y	0.89	1.00	MIA40 SGDID:S000001678,Essential protein of the mitochondrial intermembrane space, involved in import and assembly of intermembrane space proteins, Chr XI from 75826-77037, Verified ORF
YKL195W	1.00	18	1	YKL195W	KYPEHYAEQLKETSDDEEPQDK_3	Y	1	Y	0.79	1.00	MIA40 SGDID:S000001678,Essential protein of the mitochondrial intermembrane space, involved in import and assembly of intermembrane space proteins, Chr XI from 75826-77037, Verified ORF
YKL195W	1.00	18	1	YKL195W	SDENGDDNDSKNDETEAGPQLGGDK_3	Y	1	Y	0.55	1.00	MIA40 SGDID:S000001678,Essential protein of the mitochondrial intermembrane space, involved in import and assembly of intermembrane space proteins, Chr XI from 75826-77037, Verified ORF
YKL195W	1.00	18	1	YKL195W	SQQGQSDDKTTTEDNNGEEESSKK_3	Y	2	Y	0.61	1.00	MIA40 SGDID:S000001678,Essential protein of the mitochondrial intermembrane space, involved in import and assembly of intermembrane space proteins, Chr XI from 75826-77037, Verified ORF
YKL195W	1.00	18	1	YKL195W	VAEDGELVVLAEEDNKSSEDKDTDESK_3	Y	2	Y	0.50	1.00	MIA40 SGDID:S000001678,Essential protein of the mitochondrial intermembrane space, involved in import and assembly of intermembrane space proteins, Chr XI from 75826-77037, Verified ORF
YMR039C	1.00	15	1	YMR039C	EANATLIIPGQAGR_2	Y	2	Y	0.99	1.00	SUB1 SGDID:S000004642,Transcriptional coactivator, facilitates elongation by influencing enzymes that modify RNAP II, acts in a peroxide resistance pathway involving Rad2p; suppressor of TFIIB mutations, Chr XIII from 349521-348643, reverse complement, Verified ORF
YMR039C	1.00	15	1	YMR039C	EANATLIIPGQAGR_3	Y	2	Y	0.21	1.00	SUB1 SGDID:S000004642,Transcriptional coactivator, facilitates elongation by influencing enzymes that modify RNAP II, acts in a peroxide resistance pathway involving Rad2p; suppressor of TFIIB mutations, Chr XIII from 349521-348643, reverse complement, Verified ORF
YMR039C	1.00	15	1	YMR039C	IAEPEPEPVPTLQAK_2	Y	3	Y	0.94	1.00	SUB1 SGDID:S000004642,Transcriptional coactivator, facilitates elongation by influencing enzymes that modify RNAP II, acts in a peroxide resistance pathway involving Rad2p; suppressor of TFIIB mutations, Chr XIII from 349521-348643, reverse complement, Verified ORF
YMR039C	1.00	15	1	YMR039C	KKPAPPTLLPHEENIQNAER_3	Y	5	Y	1.00	1.00	SUB1 SGDID:S000004642,Transcriptional coactivator, facilitates elongation by influencing enzymes that modify RNAP II, acts in a peroxide resistance pathway involving Rad2p; suppressor of TFIIB mutations, Chr XIII from 349521-348643, reverse complement, Verified ORF
YMR039C	1.00	15	1	YMR039C	LLSDDEYEDDNNNDSTNNDKDKNGK_3	Y	1	Y	0.58	1.00	SUB1 SGDID:S000004642,Transcriptional coactivator, facilitates elongation by influencing enzymes that modify RNAP II, acts in a peroxide resistance pathway involving Rad2p; suppressor of TFIIB mutations, Chr XIII from 349521-348643, reverse complement, Verified ORF
YMR039C	1.00	15	1	YMR039C	MVRLLSDDEYEDDNNNDSTNNDKDK_3	Y	1	Y	0.93	1.00	SUB1 SGDID:S000004642,Transcriptional coactivator, facilitates elongation by influencing enzymes that modify RNAP II, acts in a peroxide resistance pathway involving Rad2p; suppressor of TFIIB mutations, Chr XIII from 349521-348643, reverse complement, Verified ORF
YMR039C	1.00	15	1	YMR039C	MVRLLSDDEYEDDNNNDSTNNDK_3	Y	1	Y	0.31	1.00	SUB1 SGDID:S000004642,Transcriptional coactivator, facilitates elongation by influencing enzymes that modify RNAP II, acts in a peroxide resistance pathway involving Rad2p; suppressor of TFIIB mutations, Chr XIII from 349521-348643, reverse complement, Verified ORF
YPL188W	0.97	3	1	YPL188W	LQSLIWQNPLQNVYITK_2	Y	2	Y	0.96	1.00	POS5 SGDID:S000006109,Mitochondrial NADH kinase, phosphorylates NADH; also phosphorylates NAD(+) with lower specificity; required for the response to oxidative stress, Chr XVI from 191405-192649, Verified ORF
YPL188W	0.97	3	1	YPL188W	SSSSADFVSPPNSK_2	Y	1	Y	0.22	1.00	POS5 SGDID:S000006109,Mitochondrial NADH kinase, phosphorylates NADH; also phosphorylates NAD(+) with lower specificity; required for the response to oxidative stress, Chr XVI from 191405-192649, Verified ORF
YGL147C	1.00	201	1	YGL147C	DEIVLSGNSVEDVSQNAADLQQICR_3	N	1	Y	0.24	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	FIEVR_1	N	1	Y	0.22	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	FLDGIYVSHK_2	N	17	Y	1.00	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	FLDGIYVSHK_3	N	2	Y	0.99	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	GFITEDL_1	Y	10	Y	0.93	1.00	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	HIDVTFTK_2	N	2	Y	1.00	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	KFLDGIYVSHK_1	N	2	Y	1.00	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	KFLDGIYVSHK_2	N	17	Y	1.00	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	KFLDGIYVSHK_3	N	10	Y	1.00	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	SLVDNMITGVTK_1	N	19	Y	0.99	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	SLVDNMITGVTK_2	N	37	Y	1.00	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	YIQTEQQIEVPEGVTVSIK_2	Y	31	Y	1.00	1.00	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	YIQTEQQIEVPEGVTVSIK_3	Y	7	Y	0.99	1.00	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	YVYAHFPINVNIVEKDGAK_3	N	7	Y	1.00	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	YVYAHFPINVNIVEK_2	N	14	Y	1.00	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YGL147C	1.00	201	1	YGL147C	YVYAHFPINVNIVEK_3	N	24	Y	1.00	0.50	RPL9A SGDID:S000003115,Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins, Chr VII from 228334-227759, reverse complement, Verified ORF
YJR126C	0.97	5	1	YJR126C	FMYLILASLLLYMGFVAAFAPR_3	Y	1	Y	0.23	1.00	VPS70 SGDID:S000003887,Protein of unknown function involved in vacuolar protein sorting, Chr X from 658605-656170, reverse complement, Verified ORF
YJR126C	0.97	5	1	YJR126C	NEVIQWLTILLSQFSNVR_3	Y	3	Y	0.35	1.00	VPS70 SGDID:S000003887,Protein of unknown function involved in vacuolar protein sorting, Chr X from 658605-656170, reverse complement, Verified ORF
YJR126C	0.97	5	1	YJR126C	TVVNMADPDDNEAEATGLQQYSGETTR_3	Y	1	Y	0.94	1.00	VPS70 SGDID:S000003887,Protein of unknown function involved in vacuolar protein sorting, Chr X from 658605-656170, reverse complement, Verified ORF
YHR073W	0.86	6	1	YHR073W	DTDYYYAFILDNSSSK_2	Y	3	Y	0.35	1.00	OSH3 SGDID:S000001115,Member of an oxysterol-binding protein family with seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability, Chr VIII from 242584-245574, Verified ORF
YHR073W	0.86	6	1	YHR073W	KILFNASVINGDNQSMISTR_3	Y	2	Y	0.26	1.00	OSH3 SGDID:S000001115,Member of an oxysterol-binding protein family with seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability, Chr VIII from 242584-245574, Verified ORF
YHR073W	0.86	6	1	YHR073W	SEGLNGTHSSSSVFTNNR_3	Y	1	Y	0.70	1.00	OSH3 SGDID:S000001115,Member of an oxysterol-binding protein family with seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability, Chr VIII from 242584-245574, Verified ORF
YOR197W	1.00	14	1	YOR197W	AALIGSLGSIFK_2	Y	7	Y	1.00	1.00	MCA1 SGDID:S000005723,Putative cysteine protease similar to mammalian caspases, involved in regulation of apoptosis upon hydrogen peroxide treatment, Chr XV from 717024-718385, Verified ORF
YOR197W	1.00	14	1	YOR197W	DVGQDGLQAAISYATGNR_2	Y	2	Y	1.00	1.00	MCA1 SGDID:S000005723,Putative cysteine protease similar to mammalian caspases, involved in regulation of apoptosis upon hydrogen peroxide treatment, Chr XV from 717024-718385, Verified ORF
YOR197W	1.00	14	1	YOR197W	LTALFDSCHSGTVLDLPYTYSTK_3	Y	1	Y	0.21	1.00	MCA1 SGDID:S000005723,Putative cysteine protease similar to mammalian caspases, involved in regulation of apoptosis upon hydrogen peroxide treatment, Chr XV from 717024-718385, Verified ORF
YOR197W	1.00	14	1	YOR197W	VMTLQPQQSYLSLLQNMR_2	Y	4	Y	1.00	1.00	MCA1 SGDID:S000005723,Putative cysteine protease similar to mammalian caspases, involved in regulation of apoptosis upon hydrogen peroxide treatment, Chr XV from 717024-718385, Verified ORF
YDR049W	0.91	1	1	YDR049W	YNLGESFTNWDETHIGQPLSR_3	Y	1	Y	0.91	1.00	YDR049W SGDID:S000002456,Hypothetical protein, Chr IV from 553252-555150, Uncharacterized ORF
YJL043W	0.90	1	1	YJL043W	YGSDYNMQIEDEDEASK_3	Y	1	Y	0.90	1.00	YJL043W SGDID:S000003579,Putative protein of unknown function; YJL043W is a non-essential gene, Chr X from 360047-360820, Uncharacterized ORF
YHR079C	1.00	11	1	YHR079C	EYNPISLLRQIASGVAHLHSLKIIHR_3	Y	1	Y	0.94	1.00	IRE1 SGDID:S000001121,Serine-threonine kinase and endoribonuclease; transmembrane protein that initiates the unfolded protein response signal by regulating synthesis of Hac1p through HAC1 mRNA splicing, Chr VIII from 261593-258246, reverse complement, Verified ORF
YHR079C	1.00	11	1	YHR079C	ILPPLYVLLSK_2	Y	1	Y	0.25	1.00	IRE1 SGDID:S000001121,Serine-threonine kinase and endoribonuclease; transmembrane protein that initiates the unfolded protein response signal by regulating synthesis of Hac1p through HAC1 mRNA splicing, Chr VIII from 261593-258246, reverse complement, Verified ORF
YHR079C	1.00	11	1	YHR079C	MLIDFCDIALMEIKLLTESDDHPNVIRYYCSETTDR_3	Y	1	Y	0.30	1.00	IRE1 SGDID:S000001121,Serine-threonine kinase and endoribonuclease; transmembrane protein that initiates the unfolded protein response signal by regulating synthesis of Hac1p through HAC1 mRNA splicing, Chr VIII from 261593-258246, reverse complement, Verified ORF
YHR079C	1.00	11	1	YHR079C	NGYFGSQSVDCSPEEK_2	Y	1	Y	0.33	1.00	IRE1 SGDID:S000001121,Serine-threonine kinase and endoribonuclease; transmembrane protein that initiates the unfolded protein response signal by regulating synthesis of Hac1p through HAC1 mRNA splicing, Chr VIII from 261593-258246, reverse complement, Verified ORF
YHR079C	1.00	11	1	YHR079C	QIASGVAHLHSLKIIHR_3	Y	1	Y	0.30	1.00	IRE1 SGDID:S000001121,Serine-threonine kinase and endoribonuclease; transmembrane protein that initiates the unfolded protein response signal by regulating synthesis of Hac1p through HAC1 mRNA splicing, Chr VIII from 261593-258246, reverse complement, Verified ORF
YHR079C	1.00	11	1	YHR079C	TNIVVNDSGKIVEDEK_3	Y	6	Y	0.67	1.00	IRE1 SGDID:S000001121,Serine-threonine kinase and endoribonuclease; transmembrane protein that initiates the unfolded protein response signal by regulating synthesis of Hac1p through HAC1 mRNA splicing, Chr VIII from 261593-258246, reverse complement, Verified ORF
YLR006C	1.00	14	1	YLR006C	DFEKQNGIGIQKSLNNSHSNLEK_3	Y	1	Y	0.21	1.00	SSK1 SGDID:S000003996,Cytoplasmic response regulator, part of a two-component signal transducer that mediates osmosensing via a phosphorelay mechanism; dephosphorylated form is degraded by the ubiquitin-proteasome system; potential Cdc28p substrate, Chr XII from 163892-161754, reverse complement, Verified ORF
YLR006C	1.00	14	1	YLR006C	EINDNASIAIGLYAPK_2	Y	3	Y	0.31	1.00	SSK1 SGDID:S000003996,Cytoplasmic response regulator, part of a two-component signal transducer that mediates osmosensing via a phosphorelay mechanism; dephosphorylated form is degraded by the ubiquitin-proteasome system; potential Cdc28p substrate, Chr XII from 163892-161754, reverse complement, Verified ORF
YLR006C	1.00	14	1	YLR006C	FDNQADNTSSNNTNDNSCRSKSNGAGSGANLSVNSNTK_3	Y	1	Y	0.87	1.00	SSK1 SGDID:S000003996,Cytoplasmic response regulator, part of a two-component signal transducer that mediates osmosensing via a phosphorelay mechanism; dephosphorylated form is degraded by the ubiquitin-proteasome system; potential Cdc28p substrate, Chr XII from 163892-161754, reverse complement, Verified ORF
YLR006C	1.00	14	1	YLR006C	FHSDNQIMASAGLTYVSPHNK_2	Y	3	Y	0.77	1.00	SSK1 SGDID:S000003996,Cytoplasmic response regulator, part of a two-component signal transducer that mediates osmosensing via a phosphorelay mechanism; dephosphorylated form is degraded by the ubiquitin-proteasome system; potential Cdc28p substrate, Chr XII from 163892-161754, reverse complement, Verified ORF
YLR006C	1.00	14	1	YLR006C	FHSDNQIMASAGLTYVSPHNK_3	Y	1	Y	0.78	1.00	SSK1 SGDID:S000003996,Cytoplasmic response regulator, part of a two-component signal transducer that mediates osmosensing via a phosphorelay mechanism; dephosphorylated form is degraded by the ubiquitin-proteasome system; potential Cdc28p substrate, Chr XII from 163892-161754, reverse complement, Verified ORF
YLR006C	1.00	14	1	YLR006C	KGLNFTTESVNDCTYK_2	Y	3	Y	0.22	1.00	SSK1 SGDID:S000003996,Cytoplasmic response regulator, part of a two-component signal transducer that mediates osmosensing via a phosphorelay mechanism; dephosphorylated form is degraded by the ubiquitin-proteasome system; potential Cdc28p substrate, Chr XII from 163892-161754, reverse complement, Verified ORF
YLR006C	1.00	14	1	YLR006C	QNGIGIQKSLNNSHSNLEK_3	Y	1	Y	0.66	1.00	SSK1 SGDID:S000003996,Cytoplasmic response regulator, part of a two-component signal transducer that mediates osmosensing via a phosphorelay mechanism; dephosphorylated form is degraded by the ubiquitin-proteasome system; potential Cdc28p substrate, Chr XII from 163892-161754, reverse complement, Verified ORF
YLR006C	1.00	14	1	YLR006C	RFSQAPVIIVALTASNSQMDKR_3	Y	1	Y	0.20	1.00	SSK1 SGDID:S000003996,Cytoplasmic response regulator, part of a two-component signal transducer that mediates osmosensing via a phosphorelay mechanism; dephosphorylated form is degraded by the ubiquitin-proteasome system; potential Cdc28p substrate, Chr XII from 163892-161754, reverse complement, Verified ORF
YLR178C	1.00	4	1	YLR178C	ENNLQLVASNFFYAETK_3	Y	1	Y	0.22	1.00	TFS1 SGDID:S000004168,Carboxypeptidase Y inhibitor, function requires acetylation by the NatB N-terminal acetyltransferase; phosphatidylethanolamine-binding protein involved in protein kinase A signaling pathway, Chr XII from 513823-513164, reverse complement, Verified ORF
YLR178C	1.00	4	1	YLR178C	IKDRPNWGYGTPATGVGK_3	Y	1	Y	1.00	1.00	TFS1 SGDID:S000004168,Carboxypeptidase Y inhibitor, function requires acetylation by the NatB N-terminal acetyltransferase; phosphatidylethanolamine-binding protein involved in protein kinase A signaling pathway, Chr XII from 513823-513164, reverse complement, Verified ORF
YLR178C	1.00	4	1	YLR178C	MNQAIDFAQASIDSYK_2	Y	2	Y	0.34	1.00	TFS1 SGDID:S000004168,Carboxypeptidase Y inhibitor, function requires acetylation by the NatB N-terminal acetyltransferase; phosphatidylethanolamine-binding protein involved in protein kinase A signaling pathway, Chr XII from 513823-513164, reverse complement, Verified ORF
YML063W	1.00	424	1	YML063W	DIFPLQNIHVR_1	N	7	Y	1.00	0.50	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	DIFPLQNIHVR_2	N	44	Y	1.00	0.50	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	DIFPLQNIHVR_3	N	29	Y	0.99	0.50	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	EVQNSTLAQLTSK_2	Y	3	Y	1.00	1.00	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	EWFDIK_1	N	9	Y	0.93	0.50	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	EWFDIK_2	N	12	Y	0.41	0.50	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	FDVGALMALHGEGSGEEKGK_2	N	7	Y	1.00	0.50	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	FDVGALMALHGEGSGEEKGK_3	N	14	Y	1.00	0.50	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	FDVGALMALHGEGSGEEK_2	N	40	Y	1.00	0.50	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	FDVGALMALHGEGSGEEK_3	N	57	Y	1.00	0.50	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	IFAIAFTR_2	N	8	Y	1.00	0.50	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	KVSGFKDEVLETV_2	Y	15	Y	1.00	1.00	RPS1B SGDID:S000004528,Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein, Chr XIII from 146482-147249, Verified ORF
YML063W	1.00	424	1	YML063W	KVSGFK_2	Y	2	Y	0.32	1.00	RPS1B SGDID:S000004528,Ribosomal pro